en · de
assay-notes.peptides7250.com › Faq › Tb-500 Identity And Molecular Background — Evidence Review

Tb-500 Identity And Molecular Background — Evidence Review

By Editorial Desk · published 2025-08-19 · last reviewed 2025-10-09 · Faq

If you have been reading about lyophilised powder and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.

Last reviewed on 2025-10-09. Where a claim depends on a specific study, the study is described rather than over-claimed.

TB-500 Identity and Molecular Background

Regulatory status differs by country, but TB-500 is not an approved pharmaceutical in major jurisdictions. It is commonly sold as a research chemical for laboratory use, which places responsibility for identity and purity on the supplier and the laboratory. Published human data are limited, and most reports involve preclinical models or cell culture. Questions about whether the fragment mimics all actions of thymosin beta-4, and under which conditions, remain open. Independent verification of any material is therefore a practical requirement in research settings.

TB-500 is a synthetic heptapeptide with the sequence Ac-LKKTETQ. It corresponds to a short N-terminal region of thymosin beta-4, a 43-amino-acid protein found in many cell types. The fragment contains an actin-binding motif, which is one reason it appears in laboratory studies of cell migration and cytoskeletal dynamics. TB-500 is not the full-length protein and is produced as a research chemical rather than an approved therapeutic agent. Its molecular weight is approximately 889 Da.

Several names appear in scientific and commercial contexts for this peptide. The label TB-500 is informal and does not follow standard biochemical nomenclature. Research articles more often describe the compound as a thymosin beta-4 fragment, Tβ4 fragment, or by its sequence Ac-LKKTETQ. Confusing TB-500 with full-length thymosin beta-4 can lead to incorrect assumptions about activity because the fragment lacks the remaining residues of the parent protein. The relationship between fragment and parent protein remains an active area of study.

Thymosin Beta-4 Fragment Identity

No major regulatory agency has approved TB-500 for therapeutic use, and it holds no pharmacopoeial monograph. The name appears on the World Anti-Doping Agency prohibited list within the class covering peptide hormones, growth factors, and related substances. Detection in doping control relies on mass spectrometric methods applied to urine, often after preparation steps that concentrate the analyte. Discussion of TB-500 therefore clusters in biochemistry, sports medicine, and anti-doping literature rather than in registered clinical trials.

TB-500 is a synthetic peptide preparation marketed under a name derived from thymosin beta-4, a 43-residue actin-binding protein first isolated from thymus tissue. The full-length protein has a reported molecular mass near 4963 Da, while material sold as TB-500 is often described as a fragment containing the actin-binding motif LKKTETQ. Because suppliers use the name inconsistently, published sources sometimes refer to the same label as a fragment, a synthetic copy, or a related analog. This naming ambiguity complicates direct comparison of reports across studies.

Tb-500 at a glance

PropertyValueNotes
Molecular formulaC38H68N10O14Calculated for the acetylated heptapeptide
Molecular weight~889 DaMonoisotopic mass approximately 889.0 Da
Amino acid sequenceAc-LKKTETQN-terminal acetylated seven-residue peptide
AppearanceWhite to off-white powderTypically supplied as a lyophilized solid
Solubility classWater-solublePeptides of this size generally dissolve in aqueous media

Handling, Storage and Analytical Checks

Purity is normally assessed by reversed-phase HPLC, with the main peak reported as a percentage of total peak area, while identity is confirmed by mass spectrometry. Electrospray and MALDI-TOF instruments are both used, and the observed mass is compared with the value calculated from the stated sequence. Ion-exchange or size-exclusion methods appear where aggregation or charge variants are of interest. Water content, counter-ion content and residual trifluoroacetate from purification are separate variables that can shift the measured mass and should be weighed when reading a certificate of analysis.

Research peptides are typically supplied as a white to off-white lyophilised powder in a sealed vial. The dry solid is more stable than a solution and is normally kept refrigerated or frozen until use. Dissolution is usually done in water, phosphate-buffered saline or a similar aqueous medium, depending on the assay. Because the material is hygroscopic and easily contaminated, opening vials in a low-humidity environment and recording the lot number before use are standard laboratory practices.

Once in solution, short peptides are generally less stable than the dry powder, and repeated freeze-thaw cycles are a common cause of loss. Laboratory guidance usually calls for aliquoting on first dissolution and storing aliquots at -20 °C or below, away from light. Adsorption to plastic and glass surfaces can lower measured concentration, particularly at low concentrations, so container material and buffer choice can affect results. Visible cloudiness, colour change or unexpected precipitate is a signal to re-check the material.

Related pages on this site

Storage and Analytical Verification

Identity and purity are normally assessed with reversed-phase high-performance liquid chromatography, paired with mass spectrometry to confirm molecular mass. A certificate of analysis reports a purity percentage, usually derived from chromatographic peak area, but that figure does not by itself prove a correct sequence or the absence of counterions. Independent verification may include amino acid analysis or peptide mapping. Batch-to-batch variation is a documented concern in the research chemical market, and the gap between a quoted purity value and actual peptide content can be substantial when the material is a salt or retains residual water.

Lyophilized peptide arrives as a dry cake that should stay sealed until use. Reconstitution is generally performed with sterile water or a buffered solution, and the resulting liquid should be handled gently to limit mechanical stress. Repeated freeze-thaw cycles are widely described as harmful to short peptides, so dividing a reconstituted batch into single-use portions is a common practice. Laboratories also record the solvent, concentration, and date of preparation on the vial label to keep later measurements traceable.

Dry powder is commonly held at minus twenty degrees Celsius, with some suppliers recommending lower temperatures for long-term archival storage. Once dissolved, solutions are typically kept cold and protected from light, since aqueous peptide solutions can lose integrity through hydrolysis or oxidation over time. Stability data specific to this fragment are limited in the public literature, and much of the guidance comes from general peptide handling practice rather than from controlled degradation studies. Users therefore treat stated shelf lives as approximate rather than fixed.

Notes from published material

The most common method for alkylation of the lactam nitrogen of 2,5-diketopiperazines is based on the use of sodium hydride as base. However epimerisation can occur especially with proline-fused 2,5-diketopiperazines, even with milder methods such as under phase-transfer catalyst conditions for example 1 to 2. Reduction of the carbonyl groups of chiral 2,5-diketopiperazine with lithium aluminium hydride (LiAlH4) cleanly gives the corresponding chiral piperazines. For example, cyclo(L-Phe-L-Phe) 1 gives the chiral piperazine (2S,5S)-dibenzylpiperazine 2. Reaction of the lactam-derived enol phosphates 4 of 2,5-diketopiperazines with palladium catalyzed reactions (reduction, Suzuki and Stille cross-coupling reactions) enables the synthesis of a range of functionalised 1,4-dihydropyrazines 5 which can be aromatized to 1,4-pyrazines 6 in the presence of acid.

Mycofactocin (MFT) is a family of small molecules derived from a peptide of the type known as RiPP (ribosomally synthesized and post-translationally modified peptides), naturally occurring in many types of Mycobacterium. It was discovered in a bioinformatics study in 2011. All mycofactocins share a precursor in the form of premycofactocin (PMFT); they differ by the cellulose tail added. Being redox active, both PMFT and MFT have an oxidized dione (mycofactocinone) form and a reduced diol (mycofactocinol) form, respectively termed PMFTH2 and MFTH2. The name "mycofactocin" is derived from three words, the genus name "Mycobacterium" (across which it is nearly universal), "cofactor" because its presence in a genome predicts the co-occurrence of certain families of enzymes as if it is a cofactor they require, and "bacteriocin" because a radical SAM enzyme critical to its biosynthesis, MftC, is closely related to the key enzyme for the biosynthesis of subtilosin A, a bacteriocin, from its precursor peptide.

Central obesity can be a feature of lipodystrophies, a group of diseases that is either inherited, or due to secondary causes (often protease inhibitors, a group of medications against AIDS). Central obesity is a symptom of Cushing's syndrome and is also common in patients with polycystic ovary syndrome (PCOS). Central obesity is associated with glucose intolerance and dyslipidemia. Once dyslipidemia becomes a severe problem, an individual's abdominal cavity would generate elevated free fatty acid flux to the liver. The effect of abdominal adiposity occurs not just in those who are obese, but also affects people who are non-obese and it also contributes to insulin sensitivity. Ghroubi et al. (2007) examined whether abdominal circumference is a more reliable indicator than BMI or the presence of knee osteoarthritis in obese patients. They found that it actually appears to be a factor linked with the presence of knee pain as well as osteoarthritis in obese study subjects. Ghroubi et al. (2007) concluded that a high abdominal circumference is associated with great functional repercussion. Research published in The Lancet (2023) found that high levels of visceral fat were related to poorer cognitive performance. The findings suggest that maintaining a healthy weight and metabolic health may be important for preserving cognitive function.

To determine saponification value, the sample is treated with an excess of alkali (usually an ethanolic solution of potassium hydroxide) for half an hour under reflux. The KOH is consumed by reaction with triglycerides, which consume three equivalents of base. Diglycerides consume two equivalents of KOH. Monoglycerides and free fatty acids, as well as other esters such as lactones, consume one equivalent of base. At the end of the reaction the quantity of KOH is determined by titration using standard solution of hydrochloric acid (HCl). Key to the method is the use of phenolphthalein indicator, which indicates the consumption of strong base (KOH) by the acid, not the weak base (potassium carboxylates). The SV (mg KOH/ g of sample) is calculated as following: Eq. 1 where: B {\displaystyle {\textrm {B}}} is the volume of HCl solution used for the blank run, in mL; S {\displaystyle {\textrm {S}}} is the volume of HCl solution used for the tested sample, in mL; M {\displaystyle {\textrm {M}}} is the molarity of HCl solution, in mol / L; 56.1 is the molecular weight of KOH, in g / mol; W

The medical historian Christoph Gradmann has reconstructed Koch's beliefs regarding the function of tuberculin: the medicine did not kill the bacteria but rather initiated a necrosis of the tubercular tissue, thus "starving" the tuberculosis pathogen. This idea was then outside customary medical theories, as it remains today. The tuberculin scandal was understood as a cautionary tale in regards to testing medicine. Emil von Behring's introduction of his diphtheria antitoxin in 1893 had been preceded by lengthy clinical testing, and the serum was only slowly introduced into practical use, accompanied by a critical discussion among qualified experts. Paul Ehrlich also proceeded with conspicuous caution in 1909 when introducing the first synthetically produced chemotherapeutic agent, Salvarsan, as a cure for an infectious disease, syphilis.

Sources: en.wikipedia.org

Background from the literature

The role of the other BDNF receptor, p75, is less clear. While the TrkB receptor interacts with BDNF in a ligand-specific manner, all neurotrophins can interact with the p75 receptor. When the p75 receptor is activated, it leads to activation of NFkB receptor. Thus, neurotrophic signaling may trigger apoptosis rather than survival pathways in cells expressing the p75 receptor in the absence of Trk receptors. Recent studies have revealed a truncated isoform of the TrkB receptor (t-TrkB) may act as a dominant negative to the p75 neurotrophin receptor, inhibiting the activity of p75, and preventing BDNF-mediated cell death.

Protein inhibition by inhibitor binding may induce obstruction in pathway regulation, homeostatic regulation and physiological function. Competitive inhibitors compete with substrate to bind to free enzymes at active sites and thus impede the production of the enzyme-substrate complex upon binding. For example, carbon monoxide poisoning is caused by the competitive binding of carbon monoxide as opposed to oxygen in hemoglobin. Uncompetitive inhibitors, alternatively, bind concurrently with substrate at active sites. Upon binding to an enzyme substrate (ES) complex, an enzyme substrate inhibitor (ESI) complex is formed. Similar to competitive inhibitors, the rate at product formation is decreased also. Lastly, mixed inhibitors are able to bind to both the free enzyme and the enzyme-substrate complex. However, in contrast to competitive and uncompetitive inhibitors, mixed inhibitors bind to the allosteric site. Allosteric binding induces conformational changes that may increase the protein's affinity for substrate. This phenomenon is called positive modulation. Conversely, allosteric binding that decreases the protein's affinity for substrate is negative modulation.

Competitive antagonists are usually structurally similar to the active compound since they are structural analogues that have to bind to the same pocket. Examples of reversible competitive antagonists like antihistamines (Figure 1) compete with histamine (Figure 2) to bind to histamine receptors, blocking the allergic response by histamine. They are used in treating histamine-mediated allergies and allergic rhinitis. Irreversible competitive antagonists like phenoxybenzamine do not dissociate from alpha-adrenergic receptors. It is used to block the activity of alpha receptors in sympathetic pathway and is used in the treatment of paroxysmal hypertension and sweating resulting from pheochromocytoma and benign prostate hyperplasia.

Milk immunity is the protection provided to immune system of an infant via the biologically active components in milk, typically provided by the infant's mother. All mammalian milk contains water, sugar, fat, vitamins, and protein, with the variation within and between species and individuals differing mainly in the amount of these components. Other than the variation in quantity of these components, not a lot is known about bio-active or immune-modulating factors in many mammalian species. However, in comparison to other mammalian milk, human milk has the most oligosaccharide diversity. Ruminant mothers do not transfer immunity to their infants during pregnancy, which makes milk the first introduction to maternal immunity calves receive. Bovine milk contains both immunoglobulins A and G, but in contrast to human milk where IgA is the most abundant, IgG is more abundant. Secretory component, IgM, both anti-inflammatory and inflammatory cytokines, and other proteins with antimicrobial functions are also present in bovine milk.

Diphtheria toxin is produced by virulent Corynebacterium diphtheriae that infect the mucosal membranes of the throat and nasal cavity causing a gray, thickened lining of the throat, sore throat, weakness, mild fever, swollen glands of the neck, and difficulty breathing. Diphtheria toxin is an ADP-ribosyltransferase that inhibits protein synthesis which causes the symptoms associated with the disease. Diphtheria used to be a leading cause of childhood death until the creation of a vaccine. The diphtheria vaccine contains a diphtheria toxoid, antigenically identical yet inactivated and non-toxic. When the toxoid is introduced to the body in a vaccine, an immune response is mounted without sequelae associated with the toxigenicity.

Sources: en.wikipedia.org

Reference notes

42. Adv Gerontol. 2004;14:105-13. [The influence of substances revealing geroprotective of spontaneous carcinogenesis in mice]. [Article in Russian] Popovich IG. The review presents the results of experimental studies conducted by the author. CBA, SHR, HER-2/neu and SAM mice revealed inhibition of age-related alterations in estrus function and spontaneous tumour development and showed life span extension under the influence of the pineal gland hormone Melatonin, synthetic peptide bioregulator Epitalon, delta-sleep-inducing peptide Deltaran, enterosorbent Aqualen and succinic acid containing preparation Neuronol (Noogam). The observed effect depended on the dose and conditions of administration, as well as genetic predisposition of the particular mice strains to tumour development.

Biopolymers are natural polymers produced by the cells of living organisms. Like other polymers, biopolymers consist of monomeric units that are covalently bonded in chains to form larger molecules. There are three main classes of biopolymers, classified according to the monomers used and the structure of the biopolymer formed: polynucleotides, polypeptides, and polysaccharides. The polynucleotides, RNA and DNA, are long polymers of nucleotides. Polypeptides include proteins and shorter polymers of amino acids; some major examples include collagen, actin, and fibrin. Polysaccharides are linear or branched chains of sugar carbohydrates; examples include starch, cellulose, and alginate. Other examples of biopolymers include natural rubbers (polymers of isoprene), suberin and lignin (complex polyphenolic polymers), cutin and cutan (complex polymers of long-chain fatty acids), melanin, and polyhydroxyalkanoates (PHAs).

The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.

Recent studies have discovered a pathway that links stress to the onset of disease through the activation of certain genes. The experience of psychological stress activates transcription factors that activate genes. In a study by Cole et al., it was concluded that GABA-1 transcription factor activates the interleukin-6-gene. This gene codes for a protein that activates the inflammatory response which directs an immune response to the site of the inflammation. Chronic inflammation makes an individual more susceptible to diseases such as cancer, heart disease, and diabetes. Another study found that physical stress caused increased cortisol:DHEAS (dehydroepiandrosterone sulphate) molar ratios which may contribute to reduced immunity, especially in the elderly for whom cortisol:DHEAS ratios are already increased. This is because DHEAS levels decrease with age while cortisol levels do not. This high ratio was found to suppress the activity of neutrophils and raise susceptibility for infection.

RdRps can be used as drug targets for viral pathogens as their function is not necessary for eukaryotic survival. By inhibiting RdRp function, new RNAs cannot be replicated from an RNA template strand, however, DNA-dependent RNA polymerase remains functional. Some antiviral drugs against Hepatitis C and COVID-19 specifically target RdRp. These include Sofosbuvir and Ribavirin against Hepatitis C and remdesivir, an FDA approved drug against COVID-19 GS-441524 triphosphate is a substrate for RdRp, but not mammalian polymerases. It results in premature chain termination and inhibition of viral replication. GS-441524 triphosphate is the biologically active form of remdesivir. Remdesivir is classified as a nucleotide analog that inhibits RdRp function by covalently binding to and interrupting termination of the nascent RNA through early or delayed termination or preventing further elongation of the RNA polynucleotide. This early termination leads to nonfunctional RNA that gets degraded through normal cellular processes. Baloxavir marboxil is an approved drug for the treatment of influenza infection. In addition, suraxavir marboxil and tivoxavir marboxil are currently undergoing clinical trials for the same indication. The development of an other inhibitor pimodivir, has been halted.

Sources: pubmed.ncbi.nlm.nih.gov

Frequently asked questions

What is TB-500?

TB-500 is a synthetic heptapeptide corresponding to a fragment of thymosin beta-4. It is used in laboratory research and is not an approved drug.

Is TB-500 identical to thymosin beta-4?

No. Thymosin beta-4 is a 43-amino-acid protein, while TB-500 represents only a short N-terminal segment. The two should not be treated as interchangeable in experimental design.

How does TB-500 appear in the literature?

It is often called a thymosin beta-4 fragment, Tβ4 fragment, or Ac-LKKTETQ. The name TB-500 is mainly a commercial or catalog label rather than a formal chemical name.

Is TB-500 the same as thymosin beta-4?

Not necessarily. TB-500 is a commercial label that suppliers apply to synthetic peptides described as thymosin beta-4 or a fragment of it. Published research most often studies the full-length protein, so statements about one do not automatically transfer to the other.

Network